General description
Testin LIM domain protein (TES) possesses three zinc-binding domains and consists of 421 amino acids. The gene encoding it is located on human chromosome 7q31.2.
Immunogen
Testin recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
Testin LIM domain protein (TES) functions as a tumor suppressor in vitro. It has important roles in protein-protein interactions and focal adhesion.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST72804
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | independent orthogonal RNAseq Learn more about Antibody Enhanced Validation |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunofluorescence: 0.25-2 μg/mL,immunohistochemistry: 1:200-1:500 |
| immunogen sequence | YCDSEKPRCAGCDELIFSNEYTQAENQNWHLKHFCCFDCDSILAGEIYVMVNDKPVCKPCYVKNHAVVCQGCHNAIDPEVQRVTYNNFSWHASTECFLCSCCSKCLIGQKFMPVEGMVFCSVECKK |
| web metadata keyword.default | Anti-TES antibody for immunoblotting 0.04-0.4 µg/mL,Anti-TES antibody with zinc-binding domains,Anti-TES antibody,Anti-TESS antibody for human tissue analysis,Anti-TESS antibody immunofluorescence 0.25-2 µg/mL,Anti-Testin antibody for cancer research,Anti-Testin antibody for cell atlas studies,Anti-Testin antibody rabbit 1:200-1:500,Anti-Testin antibody validated by Human Protein Atlas,Anti-Testin immunohistochemistry 1:200-1:500,Sigma-Aldrich Anti-TES antibody rabbit,high-quality Anti-TES antibody for research,human chromosome 7q31.2 Anti-TES antibody,immunohistochemical Anti-TES antibody,rabbit anti-Testin antibody characterization |
| UniProt accession no. | Q9UGI8 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... TES(26136) |
