General description
Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. (provided by RefSeq)
Immunogen
EPHB3 (NP_004434, 899 a.a. ~ 997 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
AASLKVIASAQSGMSQPLLDRTVPDYTTFTTVGDWLDAIKMGRYKESFVSAGFASFDLVAQMTAEDLLRIGVTLAGHQKKILSSIQDMRLQMNQTLPVQ
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3F12, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen 36.63 kDa |
| species reactivity | , human |
| technique(s) | immunoprecipitation (IP): suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2bκ |
| NCBI accession no. | NM_004443 |
| UniProt accession no. | P54753 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... EPHB3(2049) |

