General description
C1q and tumor necrosis factor related protein 6 (C1QTNF6) also known as CTRP6, is a member of C1QTNF family. It consists of a putative N-terminal signal peptide, short variable region, collagen like domain and C1q globular domain.
Immunogen
Complement C1q tumor necrosis factor-related protein 6 precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-C1QTNF6 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
C1QTNF6 (C1q and tumor necrosis factor related protein 6) is mainly involved in the fatty acid metabolism. It stimulates the phosphorylation of acetyl coenzyme A carboxylase (ACC) and fatty acid oxidation in myocytes via the AMPK-ACC pathway. In addition, C1QTNF6 also facilitates the phosphorylation and activation of the 5′-AMP-activated protein kinase (AMPK) in skeletal muscle cells. It has also been reported that interleukin-10 expression is stimulated by C1QTNF6 in macrophages thus proving the existence of an anti-inflammatory property in the protein.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST86364
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | recombinant expression orthogonal RNAseq Learn more about Antibody Enhanced Validation |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunofluorescence: 0.25-2 μg/mL,immunohistochemistry: 1:50-1:200 |
| immunogen sequence | CQRCCDSEDPLDPAHVSSASSSGRPHALPEIRPYINITILKGDKGDPGPMGLPGYMGREGPQGEPGPQGSKGDKGEMGSPGAPCQKRFFAFSVGRKTALHSGEDFQTLLFERVFVNLDGCFDMATGQFAAPLR |
| UniProt accession no. | Q9BXI9 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... C1QTNF6(114904) |

