Immunogen
Synthetic peptide directed towards the N terminal region of human MMP23B
Application
Anti-MMP23B antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
MMP23B (matrix metallopeptidase 23B) gene encodes a single-pass type II membrane protein that belongs to matrix metalloproteinase (MMP) family and is expressed primarily in ovary, testis and prostate. Matrix metalloproteinase (MMP) family proteins facilitate the breakdown of extracellular matrix (ECM) components as well as processes cytokines and growth factors. Human MMP23B stimulates TNF shedding in a cell culture system. In zebrafish, Mmp23b plays a crucial role in augmenting liver development and hepatocyte proliferation via tumor necrosis factor pathway.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ILSFPRNLLSPRETRRALAAAFRMWSDVSPFSFREVAPEQPSDLRIGFYP
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 36 kDa |
| species reactivity | guinea pig, bovine, human, mouse, dog, rat, horse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| web metadata keyword.default | 2-amino-N-hydroxybenzamide CAS number,2-amino-N-hydroxybenzamide applications in pharmaceuticals,2-amino-N-hydroxybenzamide for analytical chemistry,2-amino-N-hydroxybenzamide in quantities,2-amino-N-hydroxybenzamide reagent for organic synthesis,2-amino-N-hydroxybenzamide titration reagent,2-amino-N-hydroxybenzamide,ACS grade 2-amino-N-hydroxybenzamide,Sigma-Aldrich 2-amino-N-hydroxybenzamide,chemical 2-amino-N-hydroxybenzamide for research,high-purity 2-amino-N-hydroxybenzamide,lab-grade 2-amino-N-hydroxybenzamide |
| NCBI accession no. | NP_008914 |
| UniProt accession no. | O75900 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... MMP23B(8510) |
