General description
CPXCR1 is a candidate gene in the CPX chromosome region and is widely expressed in fetal tissues.
Rabbit Anti-CPXCR1 antibody recognizes human CPXCR1.
Immunogen
Synthetic peptide directed towards the N terminal region of human CPXCR1
Application
Rabbit Anti-CPXCR1 antibody is suitable for western blot applications at a concentration of 1.25 μg/ml.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: SDTAGNAHKNSENEPPNDCSTDIESPSADPNMIYQVETNPINREPGTATS
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 35 kDa |
| species reactivity | human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_149037 |
| UniProt accession no. | Q96RS3 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... CPXCR1(53336) |
