General description
Paired box 7 (PAX7) is encoded by the gene mapped to human chromosome 1p36.13. The encoded protein belongs to the PAX family and is expressed in central nervous system (CNS), craniofacial tissue, somites/skeletal muscle. PAX7 protein consists of paired domain (PD), an octapeptide (OP) motif and the helix-turn-helix motif of the homeodomain 1, 2 and 3 (HD1/2/3).
This gene is a member of the paired box (PAX) family of transcription factors. Members of this gene family typically contain a paired box domain, an octapeptide, and a paired-type homeodomain. These genes play critical roles during fetal development and cancer growth. The specific function of the paired box 7 gene is unknown but speculated to involve tumor suppression since fusion of this gene with a forkhead domain family member has been associated with alveolar rhabdomyosarcoma. Three transcript variants encoding different isoforms have been found for this gene. (provided by RefSeq)
Immunogen
PAX7 (NP_002575.1, 411 a.a. ~ 520 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTTGYSVDPVAGYQYGQYGQSECLVPWASPVPIPSPTPRASCLFMESYKVVSGWGMSISQMEKLKSSQMEQFT
Biochem/physiol Actions
Paired box 7 (PAX7) in muscle-derived stem cells, plays an essential role in myogenic satellite cell specification, by inhibiting alternate developmental programs. Variation in the gene expression is associated with melanoma, neuroblastoma, rhabdomyosarcoma. PAX7 and PAX3 is also implicated in skeletal muscle formation and regeneration.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 1G11, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen 37.84 kDa |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,indirect immunofluorescence: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2bκ |
| NCBI accession no. | NM_002584 |
| UniProt accession no. | P23759 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... PAX7(5081) |
