Immunogen
Synthetic peptide directed towards the C terminal of human ESRP2
Biochem/physiol Actions
Esrp2 is an mRNA splicing factor that regulates the formation of epithelial cell-specific isoforms. It specifically regulates the expression of FGFR2-IIIb, an epithelial cell-specific isoform of FGFR2. It also regulates the splicing of CD44, CTNND1, ENAH, 3 transcripts that undergo changes in splicing during the epithelial-to-mesenchymal transition (EMT). It acts by directly binding specific sequences in mRNAs and binds the GU-rich sequence motifs in the ISE/ISS-3, a cis-element regulatory region present in the mRNA of FGFR2.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LLPAARVPAAATPLAYYPGPATQLYMNYTAYYPSPPVSPTTVGYLTTPPT
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 77 kDa |
| species reactivity | rabbit, guinea pig, mouse, horse, bovine, rat, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NM_176838 |
| UniProt accession no. | Q8K0G8 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... ESRP2(80004) mouse ... Esrp2(77411) |
