General description
Achaete-scute complex homolog 2 (Drosophila), ASCL2, is a bHLH transcription factor. In mice it is expressed during the development of extraembroynic trophoblast lineages but repressed in other tissues and is essential for proper placental development.
Immunogen
Synthetic peptide directed towards the middle region of human ASCL2
Biochem/physiol Actions
Mouse ASCL2 is a member of the basic helix-loop-helix (BHLH) family of transcription factors. It is the first transcription factor shown to play a critical part in the development of the mammalian trophoblast lineage.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: AAVARRNERERNRVKLVNLGFQALRQHVPHGGANKKLSKVETLRSAVEYI
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 29 kDa |
| species reactivity | mouse, human, rat |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_032580 |
| UniProt accession no. | O35885 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | mouse ... ASCL2(17173) |
