General description
The protein encoded this gene contains two RING-finger motifs and an IBR (in between RING fingers) motif. This protein is an E3 ubiquintin ligase that is localized in Lewy bodies (LBs), a characteristic neuronal inclusion in Parkinson′s disease (PD) brains. This protein interacts with UBE2L3/UBCH7 and UBE2E2/UBCH8, but not other ubiquitin-conjugating enzymes. This protein is found to bind and ubiquitylate synphilin 1 (SNCAIP), which is a interacting protein of alpha synuclein in neurons, and a major component of LB. Alternatively spliced transcript variants encoding the same protein have been reported. (provided by RefSeq)
Immunogen
RNF19 (NP_056250, 739 a.a. ~ 837 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKTSCSHGSSDYHTRFATVNILPEVENDRLENSPHQCSISVVTQTASCSEVSQLNHIAEEHGNNGIKPNVDLYFGDALKETNNNHSHQTMELKVAIQTE
Physical form
Solution
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | ascites fluid |
| antibody product type | primary antibodies |
| clone | 4E4, monoclonal |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,western blot: 1:500-1:1000 |
| isotype | IgMκ |
| GenBank accession no. | NM_015435 |
| UniProt accession no. | Q9NV58 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... RNF19A(25897) |
