General description
PLGRKT (plasminogen receptor, C-terminal lysine transmembrane protein) is a transmembrane receptor, which has its C-terminal at the cell surface, containing an exposed lysine residue. It is a plasminogen receptor, and binds to it through its lysine residue. PLGRKT has a molecular weight of 17,261Da, and contains 147 amino acids. It is a highly conserved protein which shows high homology in different species. It has expression levels in catecholaminergic tissues. Its trancript is also expressed in pheochromocytoma tissues, medulla of adrenal gland, hippocampus, cerebral cortex, cerebellum and sympathetic neurons. PLGRKT is also highly expressed in human peripheral blood monocytes and monocytoid cells. This gene is present on the human chromosome 9p24.1.
Immunogen
Uncharacterized protein C9orf46.
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
PLGRKT (plasminogen receptor, C-terminal lysine transmembrane protein) is responsible for the activation of plasminogen, dependent on tissue plasminogen activator (t-PA). It binds to plasminogen through its C-terminal lysine, present on the cell surface, and interacts with t-PA, to activate plasminogen. It also co-localizes with urokinase-type plasminogen activator (uPA) receptor (uPAR), in human monocytes. PLGRKT is involved in migration, invasion, and recruitment of monocytes/macrophages in the inflammatory response, through uPA-dependent plasminogen activation. It is expressed in neuronal and neuroendocrine tissues, and might be implicated in the processes connecting plasminogen activation and catecholamine release.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71769
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | mouse, human, rat |
| enhanced validation | orthogonal RNAseq RNAi knockdown Learn more about Antibody Enhanced Validation |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunohistochemistry: 1:200-1:500 |
| immunogen sequence | KKPAFLVPIVPLSFILTYQYDLGYGTLLERMKGEAEDILETEKSKLQLPRGMITFESIEKARKEQSRFFIDK |
| web metadata keyword.default | Anti-C9orf46 antibody immunoblotting,Anti-PLGRKT antibody rabbit,Anti-PLGRKT antibody,C9orf46 antibody 1:200 dilution for immunohistochemistry,C9orf46 antibody for research,C9orf46 antibody rabbit,PLGRKT antibody for immunohistochemistry,PLGRKT lysine receptor antibody rabbit,PLGRKT transmembrane receptor antibody,Sigma-Aldrich Anti-PLGRKT antibody,anti-PLGRKT protein detection antibody,high purity Anti-PLGRKT antibody,immunoblotting grade Anti-PLGRKT antibody,rabbit polyclonal Anti-C9orf46 antibody |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... C9orf46(55848) |

