General description
MEOX1 is a homeobox transcription factor that regulates somite development. It is known to maintain sclerotome polarity and is also involved in axial skeleton formation. MEOX1 mutations have been linked to Klippel-Feil syndrome (KFS).
Rabbit Anti-MEOX1 bovine, canine, and human MEOX1.
Immunogen
Synthetic peptide directed towards the N terminal region of human MEOX1
Application
Rabbit Anti-MEOX1 can be used for western blot applications at a concentration of 0.2-2.0μg/ml. It can also be used for IHC at 4-8μg/ml using paraffin-embedded tissues.
Biochem/physiol Actions
MEOX1 belongs to a family of nonclustered, diverged homeobox genes. It may play a role in regulating growth and differentiation.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: YPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 28 kDa |
| species reactivity | human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_004518 |
| UniProt accession no. | P50221 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MEOX1(4222) |
