General description
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I ( I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling; and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type I receptor which signals a particular transcriptional response in concert with activin type II receptors. Mutations in this gene are associated with fibrodysplasia ossificans progressive.
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 410-509 of human ACVR1 (Q04771).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.
Application
WB
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| material | colorless |
| clone | 1J7G4, monoclonal |
| form | liquid |
| mol wt | 57 kDa |
| species reactivity | human, rat |
| concentration | 1.2 mg/mL |
| technique(s) | western blot: 1:500 - 1:1000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | VLWEVARRMVSNGIVEDYKPPFYDVVPNDPSFEDMRKVVCVDQQRPNIPNRWFSDPTLTSLAKLMKECWYQNPSARLTALRIKKTLTKIDNSLDKLKTDC |
| UniProt accession no. | Q04771 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... ACVR1(90) |

