General description
This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. (provided by RefSeq)
cAMP responsive element modulator (CREM) is encoded by the gene mapped to human chromosome 10p11.21. The encoded protein has tissue specific expression and it belongs to the family of cAMP-responsive promoter element (CRE)-binding factors. CREM contains 3′-located bZIP DNA-binding domains (DBD), kinase-inducible domain (KID) and two glutamine-rich domains.
Immunogen
CREM (NP_853549, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ATGDMPTYQIRAPTAALPQGVVMAASPGSLHSPQQLAEEATRKRELRLMKNREAAKECRRRKKEYVKCLESRVAVLEVQNKKLIEELETLKDICSPKTDY
Biochem/physiol Actions
In mice, cAMP responsive element modulator (CREM) plays a crucial role in spermatid development. CREM is an essential constituent of cAMP-mediated signal transduction, which links extracellular signals to gene regulation. The encoded protein facilitates physiological and developmental function within the hypothalamic-pituitary-gonadal axis. Elevated expression of the gene has been observed in hepatocellular carcinoma (HCC) patients.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3B5, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | immunofluorescence: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| GenBank accession no. | NM_181571 |
| UniProt accession no. | Q03060 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CREM(1390) |
