General description
Anti-Heme Oxygenase-1, mouse monoclonal, clone HO-1-1, recognizes the ~32 kDa HO-1 in a variety of species. It is validated for use in Western blotting, immunocytochemistry, and immunoprecipitation.
Protein G purified mouse monoclonal antibody. Recognizes the ~32 kDa heme oxygenase (HO-1) protein.
Recognizes the ~32 kDa HO-1 protein.
Immunogen
Human
a synthetic peptide (MERPQPDSMPQDLSEALKEATKEVHTQAEN) corresponding to amino acids 1-30 of human HO-1 prepared as a four-branched multiple antigen peptide
Application
Immunoblotting (4 µg/ml, chemiluminescence)
Immunocytochemistry (1:1000)
Immunoprecipitation (20 µg/ml)
Packaging
Please refer to vial label for lot-specific concentration.
Physical form
In PBS, 50% glycerol.
Preparation Note
Following initial thaw, aliquot and freeze (-20°C).
Other Notes
Does not cross-react with HO-2. Variables associated with assay conditions will dictate the proper working dilution.
Yoshida, T., et al. 1988. Eur. J. Biochem. 171, 457.
Maines, M.D. 1988. FASEB J.2, 2557.
Trakshel, G.M., et al. 1986 J. Biol. Chem.261, 11131.
Legal Information
CALBIOCHEM is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Toxicity: Standard Handling (A)
| biological source | mouse |
| Quality Segment | 100 |
| antibody form | purified antibody |
| antibody product type | primary antibodies |
| clone | HO-1-1, monoclonal |
| form | liquid |
| contains | ≤0.1% sodium azide as preservative |
| species reactivity | human, rat, canine, monkey, mouse, bovine |
| manufacturer/tradename | Calbiochem® |
| storage condition | OK to freeze,avoid repeated freeze/thaw cycles |
| dilution | (Immunoblotting (4 µg/mL, chemiluminescence) Immunocytochemistry (1:1000) Immunoprecipitation (20 µg/mL)) |
| isotype | IgG1 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | bovine ... Hmox1(513221) dog ... Hmox1(442987) human ... HMOX1(3162) mouse ... Hmox1(15368) rat ... Hmox1(24451) rhesus monkey ... Hmox1(719266) |
