General description
CNDP1 (carnosine dipeptidase 1) is a secreted protein, which is found in human blood and central nervous system (CNS). It has a molecular weight of 57kDa and functions as a homodimer. It is an N-glycosylated glycoprotein. It is also found in liver and belongs to the M20 metallopeptidase family.
Immunogen
Beta-Ala-His dipeptidase precursor recombinant protein epitope signature tag (PrEST)
Application
Anti-CNDP1 antibody produced in rabbit is used for sandwich immunoassay.
Anti-CNDP1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
CNDP1 (carnosine dipeptidase 1) functions as a carboxypeptidase and dipeptidase and is responsible for the degradation of carnosine and homocarnosine. It forms a complex with α-2 macroglobulin, which is a protease inhibitor. In type 2 diabetes, this gene is linked with susceptibility to nephropathy. Its reduced serum levels are linked with aggressiveness of prostate cancer. Reduced levels are also associated with lymph node metastasis. Its circulating levels are also decreased in glioblastoma, and in gastrointestinal cancer this is linked with poor outcome. Thus, it might be a putative maker for aggressive cancer and colorectal cancer.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71587
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | orthogonal RNAseq Learn more about Antibody Enhanced Validation |
| technique(s) | immunohistochemistry: 1:500- 1:1000 |
| immunogen sequence | PALLEKVFQYIDLHQDEFVQTLKEWVAIESDSVQPVPRFRQELFRMMAVAADTLQRLGARVASVDMGPQQLPDGQSLPIPPVILAELGSDPTKGTVCFYGHL |
| web metadata keyword.default | 57kDa anti-CNDP1 antibody from rabbit,CNDP1 antibody HPA validated for immunohistochemistry,CNDP1 glycoprotein antibody for sandwich assays,Sigma-Aldrich anti-CNDP1 antibody 1:500 dilution,anti-CNDP antibody for CNS research,anti-CNDP1 antibody immunohistochemistry application,anti-CNDP1 antibody rabbit polyclonal,anti-beta-alanine-histidine dipeptidase antibody,anti-carnosine dipeptidase 1 antibody lab grade,anti-glutamate carboxypeptidase-like protein 2 antibody rabbit,anti-serum carnosinase antibody for research,prestige rabbit anti-CNDP1 antibody,rabbit anti-CNDP1 antibody for immunoassay,rabbit anti-CNDP1 antibody |
| UniProt accession no. | Q96KN2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CNDP1(84735) |

