General description
HDAC6 is a histone deacetylase that associates with polyubiquitinated protein and also functions as a tubulin deacetylase. Additionally, HDAC6 is known to rescue neurodegeneration. It can also function as a mechanistic link between autophagy and ubiquitin-proteasome system during protein degradation.
Rabbit Anti-HDAC6 antibody recognizes canine, human, rat, bovine, and mouse HDAC6.
Immunogen
Synthetic peptide directed towards the N terminal region of human HDAC6
Application
Rabbit Anti-HDAC6 antibody can be used for western blot applications at 1.0μg/ml.
Biochem/physiol Actions
Histones play a critical role in transcriptional regulation, cell cycle progression, and developmental events. Histone acetylation/deacetylation alters chromosome structure and affects transcription factor access to DNA. The protein belongs to class II of the histone deacetylase/acuc/apha family. It contains an internal duplication of two catalytic domains which appear to function independently of each other. This protein possesses histone deacetylase activity and represses transcription.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: VGLQGMDLNLEAEALAGTGLVLDEQLNEFHCLWDDSFPEGPERLHAIKEQ
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| species reactivity | pig, human, dog, rabbit, horse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | ChIP: suitable,immunohistochemistry: suitable,western blot: suitable |
| web metadata keyword.default | Sigma-Aldrich rabbit anti-HDAC6 antibody,anti-HDAC6 antibody for bovine applications,anti-HDAC6 antibody for human research,anti-HDAC6 antibody for mouse tissues,anti-HDAC6 antibody for neurodegeneration research,anti-HDAC6 antibody for protein degradation studies,anti-HDAC6 antibody for rat studies,anti-HDAC6 antibody immunohistochemistry application,anti-histone deacetylase 6 antibody for cell signaling,anti-histone deacetylase 6 antibody,high-quality anti-HDAC6 antibody for ChIP,purified rabbit anti-HDAC6 antibody,rabbit anti-HDAC6 antibody for canine samples,rabbit anti-HDAC6 antibody for western blot,research-grade rabbit anti-HDAC6 antibody |
| NCBI accession no. | NP_006035 |
| UniProt accession no. | Q9UBN7 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... HDAC6(10013) |

