General description
Cytoplasmic linker protein-115 (CYLN2), also known as CAP-Gly domain containing linker protein 2 (CLIP2), possesses a structural maintenance of chromosomes (Smc) domain. The gene encoding this protein is localized on human chromosome 7q11.23.
Immunogen
CLIP2 (NP_003379, 946 a.a. ~ 1046 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LKDDIRGLREKLTGLDKEKSLSDQRRYSLIDRSSAPELLRLQHQLMSTEDALRDALDQAQQVEKLMEAMRSCPDKAQTIGNSGSANGIHQQDKAQKQEDKH
Biochem/physiol Actions
Cytoplasmic linker protein-115 (CYLN2) or CLIP2 takes part in cell division, segregation of chromosomes and in attaching organelles to microtubules. It may be useful as a marker in papillary thyroid carcinoma (PTC). Mutations in the gene encoding CYLN2 have been associated with Williams-Beuren syndrome and the protein has been shown to be expressed in colorectal carcinomas.
Features and Benefits
Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3H5, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| GenBank accession no. | NM_003388 |
| UniProt accession no. | Q9UDT6 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CLIP2(7461) |
