Immunogen
Synthetic peptide directed towards the N terminal region of human GLE1
Application
Anti-GLE1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.
Biochem/physiol Actions
GLE1 is required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. It may be involved in the terminal step of the mRNA transport through the nuclear pore complex (NPC). Mutations in GLE1 result in a fetal motoneuron disease.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LKLREAEQQRVKQAEQERLRKEEGQIRLRALYALQEEMLQLSQQLDASEQ
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 75 kDa |
| species reactivity | human, horse, rat |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| web metadata keyword.default | 1x PBS buffer Anti-GLE1 antibody sodium azide,Anti-GLE1 antibody rabbit western blot reagent,Anti-GLE1 antibody,GLE1 RNA export mediator homolog antibody western blot,GLE1 antibody Sigma-Aldrich rabbit,GLE1 antibody for protein detection,GLE1 antibody purified for lab use,anti-GLE1 antibody 2% sucrose formulation,anti-GLE1L rabbit antibody for research,anti-hGLE1 antibody western blotting,high-quality Anti-GLE1 antibody for western blot,purified Anti-GLE1 antibody rabbit 1µg/mL,research use Anti-GLE1 antibody,synthetic peptide GLE1 antibody western blot |
| NCBI accession no. | NP_001003722 |
| UniProt accession no. | Q53GS7 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... GLE1(2733) |
