Immunogen
BolA-like protein 1 recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
BOLA1 (BolA family member 1) is an aerobic, mitochondrial protein belonging to the BolA family. It consists of a specific helix-turn-helix motif. There are three types of secreted BOLA proteins present in human, BOLA1, BOLA2, and BOLA3. It mainly prevents the changes in mitochondrial morphology caused by glutathione (GSH) depletion through balancing mitochondrial thiol-redox potential. It has also been reported that BOLA1 may also play an important role in the cell proliferation and cell-cycle regulation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST70989
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunohistochemistry: 1:20- 1:50 |
| immunogen sequence | SPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGT |
| web metadata keyword.default | Anti-BOLA1 antibody rabbit Sigma-Aldrich,Anti-BOLA1 antibody sc-101894,Anti-BOLA1 antibody,Anti-BolA-like protein 1 antibody rabbit HPA,BOLA1 antibody 1:20 dilution immunohistochemistry,BOLA1 antibody Prestige Antibodies Atlas,BOLA1 antibody direct from Sigma-Aldrich,BOLA1 antibody immunohistochemistry validated,BOLA1 antibody rabbit polyclonal,affordable Anti-BOLA1 antibody for lab research,anti-BOLA1 antibody for Human Tissue Atlas studies,anti-BOLA1 antibody for immunohistochemical applications,high-quality anti-BOLA1 antibody for scientific use,rabbit Anti-BOLA1 antibody for Cancer Atlas research,validated Anti-BOLA1 antibody for cell studies |
| UniProt accession no. | Q9Y3E2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... BOLA1(51027) |

