General description
ACOX2 (acyl-CoA oxidase 2) is the rate limiting enzyme located on human chromosome 3p14. It codes for the peroxisomal branched-chain acyl-CoA oxidase. ACOX2 is expressed in the liver and kidney.
Immunogen
acyl-CoA oxidase 2, branched chain
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-ACOX2 antibody has been used in western blotting.
Biochem/physiol Actions
ACOX2 (acyl-CoA oxidase 2) participates in the β-oxidation of branched, long chain fatty acids and in the production of bile-acid precursor molecules. Loss of ACOX2 leads to inborn error of bile acid production with persistent hypertransaminasemia. ACOX2 may participates in the degradation of long branched fatty acids (phytanic and pristanic acids).
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
Other Notes
Corresponding Antigen APREST90117
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | independent orthogonal RNAseq recombinant expression Learn more about Antibody Enhanced Validation |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunofluorescence: 0.25-2 μg/mL,immunohistochemistry: 1:200-1:500 |
| immunogen sequence | VTVKGFTEALEKLENEPAIQQVLKRLCDLHAIHGILTNSGDFLHDAFLSGAQVDMARTAYLDLLRLIRKDAILLTDAFDFTDQCL |
| web metadata keyword.default | ACOX2 acyl-CoA oxidase 2 antibody,ACOX2 antibody for immunoblotting,ACOX2 antibody for immunohistochemistry 1:200,ACOX2 antibody for liver and kidney studies,ACOX2 antibody immunofluorescence 0.25-2 µg/mL,ACOX2 antibody pricing for purchases,ACOX2 antibody tissue localization studies,ACOX2 antibody,ACOX2 rabbit polyclonal antibody for research,anti-ACOX2 antibody validated by Human Protein Atlas,custom ACOX2 antibody orders available,high-quality ACOX2 antibody rabbit,lab-grade anti-ACOX2 antibody for immunoassays,rabbit anti-ACOX2 antibody Sigma-Aldrich,validated ACOX2 antibody for protein research |
| UniProt accession no. | Q99424 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... ACOX2(8309) |

