Immunogen
40S ribosomal protein S24 recombinant protein epitope signature tag (PrEST)
Application
Anti-RPS24 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
RPS24 (ribosomal protein S24) gene encodes a component of the ribosomal 40S subunit. Ribosomes catalyze protein synthesis. The protein is a member of the S24E family of ribosomal proteins. Defects in this gene cause Diamond-Blackfan anemia that is characterized by macrocytic anemia, erythroblastopenia, and an increased risk of developing leukemia. It also disrupts ribosomal biogenesis and pre-rRNA maturation. The gene is localized to human chromosome 10q22-q23.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST86604
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunofluorescence: 0.25-2 μg/mL,immunohistochemistry: 1:20-1:50 |
| immunogen sequence | TNRLLQRKQMVIDVLHPGKATVPKTEIREKLAKMYKTTPDVIFVFGFRTHFGGGKTTGFGMIYDSLDYAKKNEPKHRLARHGLYEKKKTSRKQRKERKNRMK |
| web metadata keyword.default | Anti-40S ribosomal protein S24 antibody immunohistochemistry,Anti-40S ribosomal protein S24 for tissue studies,Anti-RPS24 antibody for cancer research,Anti-RPS24 antibody for research,Anti-RPS24 antibody immunofluorescence protocol,Anti-RPS24 antibody rabbit Sigma-Aldrich,Prestige Antibody Anti-RPS24 rabbit,RPS24 antibody 0.25-2 µg/mL immunofluorescence,RPS24 antibody Western blotting applications,RPS24 antibody sc-160744,Rabbit anti-RPS24 antibody 1:20 immunohistochemistry,Ribosomal Protein S24 antibody HPA validated,high-quality Anti-RPS24 antibody for labs,immunohistochemistry tested Anti-RPS24 antibody |
| UniProt accession no. | P62847 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... RPS24(6229) |

