General description
Interleukin 8 (IL-8) is an 8& kDa, 72 amino acid residue containing cytokine that belongs to C-X-C chemokine family. The IL-8 gene is mapped to human chromosomes 4q13.3. IL-8 chemokine is secreted by several cell types. The IL-8 gene is believed to play a role in the pathogenesis of bronchiolitis, a common respiratory tract disease caused by viral infection.
Immunogen
IL8 (AAH13615, 21 a.a. ~ 99 a.a) full length recombinant protein.
Sequence
EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS
Biochem/physiol Actions
Elevated expression of IL-8 gene is observed in a number of cancers including chronic spontaneous urticaria and breast cancer, thus serves as a prognostic marker for the same. IL-8 regulates the metastasis and angiogenesis processes during cancer development. IL-8 is responsible for epithelial–mesenchymal transition which plays an important role in providing cancer cells the mobility to invade other neighbouring cells, thereby contributing to metastasis.
Interleukin-8 (IL-8) chemoattracts and activates neutrophils. It is involved in guiding neutrophils and oligodendrocytes to sites of infection. The protein also stimulates angiogenesis and tumor growth. It is also associated with inflammatory diseases.
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 4E3, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen 8.69 kDa |
| species reactivity | human |
| technique(s) | immunoprecipitation (IP): suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2bκ |
| NCBI accession no. | BC013615 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... IL8(3576) |
