General description
The protein encoded by this gene, a member of the G protein-coupled receptor family 1, is an integral plasma membrane protein which binds melanin-concentrating hormone. The encoded protein can inhibit cAMP accumulation and stimulate intracellular calcium flux, and is probably involved in the neuronal regulation of food consumption. Although structurally similar to somatostatin receptors, this protein does not seem to bind somatostatin. (provided by RefSeq)
Immunogen
MCHR1 (AAH21146.1, 1 a.a. ~ 422 a.a) full-length human protein.
Sequence
MSVGAMKKGVGRAVGLGGGSGCQATEEDPLPDCGACAPGQGGRRWRLPQPAWVEGSSARLWEQATGTGWMDLEASLLPTGPNASNTSDGPDNLTSAGSPPRTGSISYINIIMPSVFGTICLLGIIGNSTVIFAVVKKSKLHWCNNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLITAMDANSQFTSTYILTAMAIDRYLATVHPISSTKFRKPSVATLVICLLWALSFISITPVWLYARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVRILQRMTSSVAPASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLGYANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRAVSNAQTADEERTESKGT
Application
Anti-MCHR1 antibody produced in rabbit is suitable for western blot analysis.
Biochem/physiol Actions
MCHR1 (melanin-concentrating hormone receptor 1) is involved in various biological processes such as in regulation of energy balance, food intake, physical activity and body weight. It is majorly associated with the neurotransmitter and neuropeptide systems, which are a part of regulation of food intake and energy balance. It forms complex with G proteins to inhibit adenylyl cyclase and with G proteins that activate phosphoinositide hydrolysis. The gene is associated with the schizophrenia disease since it has influence on schizophrenia susceptibility. It mediates Gα(i)-dependent signaling pathway. It has also been reported that MCHR1 regulates the orexigenic activity of melanin-concentrating hormone (MCH).
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~46 kDa |
| species reactivity | human |
| technique(s) | western blot: 1 μg/mL |
| NCBI accession no. | BC021146 |
| UniProt accession no. | Q99705 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MCHR1(2847) |

