General description
This gene is a member of the tropomyosin family of highly conserved, widely distributed actin-binding proteins involved in the contractile system of striated and smooth muscles and the cytoskeleton of non-muscle cells. Tropomyosin is composed of two alpha-helical chains arranged as a coiled-coil. It is polymerized end to end along the two grooves of actin filaments and provides stability to the filaments. The encoded protein is one type of alpha helical chain that forms the predominant tropomyosin of striated muscle, where it also functions in association with the troponin complex to regulate the calcium-dependent interaction of actin and myosin during muscle contraction. In smooth muscle and non-muscle cells, alternatively spliced transcript variants encoding a range of isoforms have been described. Mutations in this gene are associated with type 3 familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin 1 (P09493).
PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.
Application
WB, IHC, IF/ICC, IP
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| material | colorless |
| clone | 5Q2H6, monoclonal |
| form | liquid |
| mol wt | 37 kDa |
| species reactivity | mouse, rat |
| concentration | 0.3 mg/mL |
| technique(s) | immunofluorescence: 1:50 - 1:200,immunohistochemistry: 1:50 - 1:200,immunoprecipitation (IP): 1:50 - 1:200,western blot: 1:500 - 1:2000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI |
| UniProt accession no. | P09493 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... TPM1(7168) |
