General description
Growth factor independent protein 1 (GFI1) is a zinc finger DNA-binding protein with an N-terminal SNAIL/Gfi-1 (SNAG) domain and C-terminal Zinc finger motifs. The GFI1 gene is mapped to human chromosome 1p22.1.
Immunogen
GFI1 (NP_005254, 1 a.a. ~ 91 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MPRSFLVKSKKAHSYHQPRSPGPDYSLRLENVPAPSRADSTSNAGGAKAEPRDRLSPESQLTEAPDRASASPRQLRSSVCERSSEFEDFWR
Biochem/physiol Actions
Growth factor independent protein 1 (GFI1) regulates lymphomagenesis and differentiation of hematopoietic and non-hematopoietic tissues especially those associated with lungs, intestine, and inner ear hair cells. It acts as a transcriptional repressor protein that recruits histone demethylase complex (LSD-1) and histone deacetylases. Gfi1 serves as a mediator of the cell cycle and apoptosis. It favors multiple myeloma tumor progression and chemoresistance. Mutation in the GFI1 gene is implicated in severe congenital neutropenia (SCN).
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3G8, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable,indirect ELISA: suitable,indirect immunofluorescence: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| GenBank accession no. | NM_005263 |
| UniProt accession no. | Q99684 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... GFI1(2672) |
