Immunogen
Synthetic peptide directed towards the C terminal region of human RHOD
Biochem/physiol Actions
Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. RHOD binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Ras homolog, or Rho, proteins interact with protein kinases and may serve as targets for activated GTPase. They play a critical role in muscle differentiation. The protein encoded by this gene binds GTP and is a member of the small GTPase superfamily. It is involved in endosome dynamics and reorganization of the actin cytoskeleton, and it may coordinate membrane transport with the function of the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: NGLEPVTYHRGQEMARSVGAVAYLECSARLHDNVHAVFQEAAEVALSSRG
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 23 kDa |
| species reactivity | human, guinea pig, rat, dog, bovine |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| web metadata keyword.default | Anti-RHOD antibody for cell signaling studies,Anti-RHOD antibody for immunohistochemistry,Anti-RHOD antibody for western blotting,Anti-RHOD antibody rabbit Sigma-Aldrich,Anti-RHOD antibody sc-27879,Anti-RHOD antibody sc-376340,Anti-RHOD antibody with sodium azide and sucrose,Anti-RHOD antibody,Anti-RHOD peptide antibody,Anti-RHOD rabbit antibody for protein detection,Anti-RHOD rabbit antibody,Anti-RHOD rabbit polyclonal antibody 1mg,Anti-Ras homolog gene family member D antibody,purified Anti-RHOD antibody 1x PBS buffer,research-use Anti-RHOD antibody |
| NCBI accession no. | NP_055393 |
| UniProt accession no. | O00212 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... RHOD(29984) |

