General description
CD74 (cluster of differentiation 74) is the invariant chain of MHC (major histocompatibility) complex class II. It was the first receptor to be recognized for macrophage migration inhibitory factor (MIF). It is a membrane receptor.
Immunogen
HLA class II histocompatibility antigen γ-chain recombinant protein epitope signature tag (PrEST)
Application
Anti-CD74 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
CD74 (cluster of differentiation 74) acts as the chaperone of MHC-II (major histocompatibility) and is responsible for the trafficking of MHC-II molecules in APCs (antigen presenting cells). It also interacts with non-MHC proteins and functions as a receptor for MIF (macrophage migration inhibitory factor). MIF is a pleiotropic cytokine having pro-tumorigenic and pro-inflammatory functionality. It is involved in the progression and metastasis of hematologic and solid cancers, and its up-regulation in thyroid cancer might be linked with advanced tumor stage. In patients with malignant pleural mesothelioma, the over-expression of this protein functions as an independent prognostic marker for overall survival.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71660
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| enhanced validation | orthogonal RNAseq Learn more about Antibody Enhanced Validation |
| technique(s) | immunoblotting: 0.04-0.4 μg/mL,immunohistochemistry: 1:500-1:1000 |
| immunogen sequence | PKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPK |
| UniProt accession no. | P04233 |
| application(s) | research pathology |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CD74(972) |

