General description
Microtubules are involved in a wide variety of cellular processes, including mitosis, morphogenesis, platelet formation, and mobility of cilia and flagella. Circulating platelets carry a single marginal microtubule coil that is wound in 8 to 12 turns and is responsible for platelet shape. TUBB1 is the major beta-tubulin expressed in platelets and megakaryocytes and is required for optimal platelet assembly (Wang et al., 1986 [PubMed 3782288]; Schulze et al., 2004 [PubMed 15315966]).[supplied by OMIM
Immunogen
TUBB1 (NP_110400.1, 1 a.a. ~ 451 a.a) full-length human protein.
Sequence
MREIVHIQIGQCGNQIGAKFWEMIGEEHGIDLAGSDRGASALQLERISVYYNEAYGRKYVPRAVLVDLEPGTMDSIRSSKLGALFQPDSFVHGNSGAGNNWAKGHYTEGAELIENVLEVVRHESESCDCLQGFQIVHSLGGGTGSGMGTLLMNKIREEYPDRIMNSFSVMPSPKVSDTVVEPYNAVLSIHQLIENADACFCIDNEALYDICFRTLKLTTPTYGDLNHLVSLTMSGITTSLRFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTAQGSQQYRALSVAELTQQMFDARNTMAACDLRRGRYLTVACIFRGKMSTKEVDQQLLSVQTRNSSCFVEWIPNNVKVAVCDIPPRGLSMAATFIGNNTAIQEIFNRVSEHFSAMFKRKAFVHWYTSEGMDINEFGEAENNIHDLVSEYQQFQDAKAVLEEDEEVTEEAEMEPEDKGH
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~50.3 kDa |
| species reactivity | rat, human |
| technique(s) | western blot: 1 μg/mL |
| NCBI accession no. | NM_030773 |
| UniProt accession no. | Q9H4B7 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... TUBB1(81027) |
