General description
GTF2I is a phosphoprotein transcription factor that has six typical repeat motifs. Mutations in this gene have been implicated in Williams Syndrome.
Rabbit Anti-GTF2I antibody recognizes chicken, rat, mouse, bovine, human, and canine GTF2I.
Immunogen
Synthetic peptide directed towards the N terminal region of human GTF2I
Application
Rabbit Anti-GTF2I antibody can be used for western blot (0.5μg/ml) and IHC (4-8μg/ml, using paraffin-embedded tissues) assays.
Biochem/physiol Actions
GTF2I encodes a multifunctional phosphoprotein with roles in transcription and signal transduction. It is deleted in Williams-Beuren syndrome, a multisystem developmental disorder caused by the deletion of contiguous genes at chromosome 7q11.23. The exon(s) encoding 5′ UTR has not been fully defined, but this gene is known to contain at least 34 exons, and its alternative splicing generates 4 transcript variants.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSH
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 110 kDa |
| species reactivity | rat, rabbit, dog, human, guinea pig, horse, mouse, bovine |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_127492 |
| UniProt accession no. | Q75M86 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... GTF2I(2969) |
