Immunogen
Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 3 (Membrane-associated guanylate kinase inverted 3) (MAGI-3)
Application
Anti-MAGI3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biochem/physiol Actions
MAGI3 (membrane associated guanylate kinase, WW and PDZ domain containing 3) gene encodes a membrane-associated guanylate kinase that contains multi-PDZ domains. It is a scaffolding protein that is found at cell-cell junctions. It interacts with frizzled-4 and -7 (seven-transmembrane proteins involved in PCP/ planar cell polarity pathway) and Ltap (a mouse homolog of the Drosophila PCP protein, stbm) to form a complex. This complex is found to activate JNK signaling cascade. It binds to the (PDZ) recognition motif (TVV) that is present at the C-terminal of the transforming growth factor-α precursor (proTGFα) and facilitates efficient trafficking of TGFα to the cell surface in polarized epithelial cells. MAGI3 binds to the PDZ domain-binding site of PTEN/MMAC, a tumor suppressor, and modulates the kinase activity of AKT/PKB (protein kinase B). It binds to the PDZ-binding domain of LPA2 (lysophosphatidic acid 2) and regulates the ability of LPA2 to activate Erk (extracellular signal regulated kinase) and RhoA.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST71112
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunohistochemistry: 1:20- 1:50 |
| immunogen sequence | LKVGDHISAVNGQSIVELSHDNIVQLIKDAGVTVTLTVIAEEEHHGPPSGTNSARQSPALQHRPMGQSQANHIPGDRSALEGEIGKDVSTSYRHSWSDHKHLAQPDTAVISVVGSRHNQNLGCYPVELERGPRGFGFSLRG |
| UniProt accession no. | Q5TCQ9 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MAGI3(260425) |

