Immunogen
Synthetic peptide directed towards the middle region of human SLC16A6
Biochem/physiol Actions
SLC16A6 is a proton-linked monocarboxylate transporter.It catalyzes the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 57 kDa |
| species reactivity | rabbit, horse, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| UniProt accession no. | O15403 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... SLC16A6(9120) |
