Immunogen
Synthetic peptide directed towards the N terminal region of human PARL
Application
Anti-PARL antibody produced in rabbit is suitable for western blotting at a concentration of 0.5μg/ml and for immunohistochemistry of paraffin-embedded tissue sections at a concentration of 4-8μg/ml.
Biochem/physiol Actions
Presenilin-associated rhomboid-like (PARL) is a mitochondrial rhomboid serine protease reported to mediate the cleavage of PINK1, a mitochondrial Ser/Thr protein kinase.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 36 kDa |
| species reactivity | mouse, rabbit, horse, pig, human, rat, dog |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_061092 |
| UniProt accession no. | Q9H300-2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... PARL(55486) |
