General description
NKRF codes for a nuclear protein that functions as a repressing factor for NF-κB. NKRF suppresses the stimulation of hiNOS, IL-8, IFN, and HIV-1 by NFκB.
Rabbit Anti-NKRF antibody recognizes bovine, human, mouse, rat, and canine NKRF.
Immunogen
Synthetic peptide directed towards the N terminal region of human NKRF
Application
Rabbit Anti-NKRF antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
NKRF is a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. NKRF localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.This gene encodes a transcription factor that interacts with specific negative regulatory elements (NREs) to mediate transcriptional repression of certain NK-kappa-B-responsive genes. The protein localizes predominantly to the nucleolus with a small fraction found in the nucleoplasm and cytoplasm.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MEKILQMAEGIDIGEMPSYDLVLSKPSKGQKRHLSTCDGQNPPKKQAGSK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 44 kDa |
| species reactivity | human, pig, horse, dog |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| web metadata keyword.default | 2.5 µg/ml Rabbit Anti-NKRF antibody,Anti-NF-kappaB repressing factor antibody for western blot,Anti-NKRF antibody Sigma-Aldrich,Anti-NKRF antibody for bovine tissue analysis,Canine NKRF antibody research reagent,NKRF protein detection antibody,Purified Rabbit Anti-NKRF antibody 1x PBS,Rabbit Anti-NKRF antibody for mouse studies,Rabbit Anti-NKRF antibody with sodium azide,Rabbit Anti-NKRF antibody,Rabbit polyclonal antibody against NKRF,Research grade Rabbit Anti-NKRF antibody,Western blot NKRF antibody for human samples |
| NCBI accession no. | NP_060014 |
| UniProt accession no. | O15226 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... NKRF(55922) |
