General description
ZNF444 codes for a zinc finger protein that stimulates the transcription of a scavenger receptor gene. This subsequently plays a role in the breakdown of acetylated low density lipoprotein (Ac-LDL). The EWSR1-ZNF444 fusion gene has been implicated in myoepithelial carcinomas of soft tissues.
Rabbit Anti-ZNF444 antibody recognizes human, mouse, rat, canine, and bovine ZNF444.
Immunogen
Synthetic peptide directed towards the C terminal region of human ZNF444
Application
Rabbit Anti-ZNF444 antibody is suitable for western blot applications at a concentration of 2.5 μg/ml.
Biochem/physiol Actions
ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, which strongly suggested that ZNF444 is a transcriptional regulator.ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).[supplied by OMIM].
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: ACCECGKTFYWREHLVRHRKTHSGARPFACWECGKGFGRREHVLRHQRIH
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 35 kDa |
| species reactivity | mouse, rabbit, human, rat, dog, bovine |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_060807 |
| UniProt accession no. | Q8N0Y2 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... ZNF444(55311) |
