General description
This gene encodes a member of the membrane fatty acid desaturase family which is responsible for inserting double bonds into specific positions in fatty acids. This protein contains three His-containing consensus motifs that are characteristic of a group of membrane fatty acid desaturases. It is predicted to be a multiple membrane-spanning protein localized to the endoplasmic reticulum. Overexpression of this gene inhibited biosynthesis of the EGF receptor, suggesting a possible role of a fatty acid desaturase in regulating biosynthetic processing of the EGF receptor. Two splice variants have been identified. (provided by RefSeq)
Immunogen
DEGS1 (NP_003667, 226 a.a. ~ 323 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
SGHFIAEHYMFLKGHETYSYYGPLNLLTFNVGYHNEHHDFPNIPGKSLPLVRKIAAEYYDNLPHYNSWIKVLYDFVMDDTISPYSRMKRHQKGEMVLE
Physical form
Clear solution
| biological source | mouse |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | ascites fluid |
| antibody product type | primary antibodies |
| clone | 3F9, monoclonal |
| mol wt | antigen ~36.89 kDa |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,western blot: 1:500-1:1000 |
| isotype | IgMκ |
| NCBI accession no. | NM_003676 |
| UniProt accession no. | O15121 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... DEGS1(8560) |

