Immunogen
Synthetic peptide directed towards the C terminal region of human SLC25A29
Biochem/physiol Actions
SLC25A29 is a member of solute carrier (SLC) family 25 of transporters also called as mitochondrial carrier family. The members of this family are present in the inner mitochondrial membranes and connect cytoplasmic and mitochondrial matrices. SLC25A29 is involved in the transport of basic amino acids into the mitochondria, protein synthesis and amino acid degradation in mitochondria.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: AEGWRVFTRGLASTLLRAFPVNAATFATVTVVLTYARGEEAGPEGEAVPA
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 33 kDa |
| species reactivity | human, bovine, dog, rabbit, guinea pig, horse, rat, mouse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_001034444 |
| UniProt accession no. | Q8N8R3 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... SLC25A29(123096) |

