Immunogen
Protein phosphatase 1 regulatory subunit 3F recombinant protein epitope signature tag (PrEST)
Application
All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Biochem/physiol Actions
PPP1R3F is also known as R3F and HB2E. ZPPP1R3F expresses a glycogen-binding protein (R3F) of 82.8kDa and is found at high levels in rodent brain. It binds to protein phosphatase 1 (PP1) by ′RVxF′ binding motif. It has a hydrophobic domain at the carboxy-terminus of R3F. It binds to glycogen, as well as membranes. Glycogen synthase interacts with PP1-R3F and is hyperphosphorylated at glycogen synthase kinase-3 sites (Ser640 and Ser644) when it is bound to R3F. Phosphorylation of PP1-R3F bound GS at Ser640 and Ser644 increases due to depletion of glucose or stimulation with adenosine or noradrenaline. This inhibits glycogen synthesis and facilitates glycogen degradation to provide glucose in astrocytoma cells. R3F phosphorylation is also modulated by adenosine stimulation.
Features and Benefits
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Physical form
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Other Notes
Corresponding Antigen APREST74009
Legal Information
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| product line | Prestige Antibodies® Powered by Atlas Antibodies |
| form | buffered aqueous glycerol solution |
| species reactivity | human |
| technique(s) | immunohistochemistry: 1:50- 1:200 |
| immunogen sequence | TDGGMSPSHPLGILTDRDLILKWPGPERALNSALAEEITLHYARLGRGVELIKDTEDPDDEGEGEEGLSVTPSSPEGDSPKESPPEILSGARSVVATMGDVWLP |
| web metadata keyword.default | Anti-PPP1R3F antibody Human Protein Atlas project,Anti-PPP1R3F antibody for immunohistochemistry 1:50-1:200,Anti-PPP1R3F antibody for laboratory use,Anti-PPP1R3F antibody for tissue analysis,Anti-PPP1R3F antibody rabbit Sigma-Aldrich,Anti-PPP1R3F antibody,Anti-PPP1R3F immunohistochemistry reagent,Anti-Protein phosphatase 1 regulatory subunit 3F antibody rabbit,Sigma-Aldrich rabbit anti-PPP1R3F antibody,anti-PPP1R3F antibody for research applications,high-quality Anti-PPP1R3F antibody rabbit,rabbit Anti-PPP1R3F antibody with extensive characterization,rabbit anti-PPP1R3F antibody immunohistochemistry,recombinant Anti-PPP1R3F antibody rabbit,validated Anti-PPP1R3F antibody for cancer research |
| UniProt accession no. | Q6ZSY5 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... PPP1R3F(89801) |

