Immunogen
Synthetic peptide directed towards the middle region of human ATP7A
Biochem/physiol Actions
The ATP7A gene encodes the Menkes copper-translocating P-type ATPase, a ubiquitous protein that regulates the absorption of copper in the gastrointestinal tract. Inside cells, this protein has a dual function: it delivers copper to cuproenzymes in the Gol
Other Notes
Synthetic peptide located within the following region: SSLFLKLYRKPTYESYELPARSQIGQKSPSEISVHVGIDDTSRNSPKLGL
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Segment | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| mol wt | 163 kDa |
| species reactivity | horse, rat, human, mouse, dog, guinea pig, rabbit, bovine |
| packaging | pkg of 100 μL buffered aqueous solution,pkg of 50 μg lyophilized powder |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NM_000052 |
| UniProt accession no. | Q04656 |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... ATP7A(538) |
