General description
Homeobox B7 (HOXB7) is part of the HOX gene family and is expressed in embryonic tissues. The gene encoding it is localized on human chromosome 17q21.32.
Immunogen
HOXB7 (NP_004493, 55 a.a. ~ 120 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MQGLYPGGGGMAGQSAAGVYAAGYGLEPSSFNMHCAPFEQNLSGVCPGDSAKAAGAKEQRDSDLAA
Biochem/physiol Actions
Homeobox B7 (HOXB7) has a role in many cellular processes. It has been shown to be expressed in hepatocellular carcinoma. HOXB7 may also have a role in cell migration and invasion in gastric cancer. This transcription factor is vital for tissue differentiation and embryogenesis. HOXB7 may be a potential drug target in various cancers. The protein has the capacity to induce the expression of genes associated with tumor invasion and angiogenesis.
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 4C6, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen 33 kDa |
| species reactivity | human |
| technique(s) | immunohistochemistry: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| NCBI accession no. | NM_004502 |
| UniProt accession no. | P09629 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... HOXB7(3217) |
