General description
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. (provided by RefSeq)
Immunogen
HNF4A (NP_000448, 324 a.a. ~ 423 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 1F12, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~37.11 kDa |
| species reactivity | human |
| technique(s) | indirect ELISA: suitable,indirect immunofluorescence: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| NCBI accession no. | NM_000457 |
| UniProt accession no. | P41235 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... HNF4A(3172) |

