General description
SLC30A9 is a member of the solute carrier family that may function as a zinc transporter.
Rabbit Anti-SLC30A9 antibody recognizes human, canine, and pig SLC30A9.
Immunogen
Synthetic peptide directed towards the N terminal region of human SLC30A9
Application
Rabbit Anti-SLC30A9 (AB2) antibody can be used for western blot applications at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
HUEL includes the putative nuclear receptor interaction motif, nuclear localization and export signals, zinc finger, leucine zipper and acidic domains. HUEL is likely to be an evolutionarily conserved, housekeeping gene that plays a role intimately linked with cellular replication, DNA synthesis and/or transcriptional regulation.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: LSQVKLYSTNVQKEGQGSQTLRVEKVPSFETAEGIGTELKAPLKQEPLQV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 63 kDa |
| species reactivity | rat, human, dog |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_006336 |
| UniProt accession no. | Q6PML9 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... SLC30A9(10463) |
