Immunogen
Synthetic peptide directed towards the C terminal region of human SEPT9(septin 9)
Application
Anti-SEPT9 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5 μg/ml.
Biochem/physiol Actions
Septin 9 (SEPT9; SeptD1) is a member of the septin family and is involved in cell cycle control and cytokinesis. Members of this family form complexes and filamentous structures that maintain the cytoskeleton. The septin proteins act as scaffolds to recruit proteins to specific cellular locations. Septin 9 interacts with bundle microtubules and is altered in neuralgic amyotrophy. It has been found to be hypermethylated in certain cancers.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: HCEFAYLRDLLIRTHMQNIKDITSSIHFEAYRVKRLNEGSSAMANGMEEK
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 37 kDa |
| species reactivity | human, rat, guinea pig, mouse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | western blot: suitable |
| NCBI accession no. | NP_006631 |
| UniProt accession no. | Q9UHD8 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... SEPT9(septin 9) |

