General description
Ki-67 (antigen KI-67) has a gene size of 29,545 bp and it consists of 15 exons and 14 introns. It has a minus strand orientation. This gene is located on human chromosome 10q26.2.
This gene encodes a nuclear protein that is associated with and may be necessary for cellular proliferation. Alternatively spliced transcript variants have been described. A related pseudogene exists on chromosome X. (provided by RefSeq)
Immunogen
MKI67 (NP_002408, 3157 a.a. ~ 3256 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
RSARQNESSQPKVAEESGGQKSAKVLMQNQKGKGEAGNSDSMCLRSRKTKSQPAASTLESKSVQRVTRSVKRCAENPKKAEDNVCVKKIRTRSHRDSEDI
Application
Monoclonal Anti-MKI67 antibody has been used in immunohistochemistry (IHC).
Biochem/physiol Actions
Ki-67 (antigen KI-67) protein acts as a cellular marker for proliferation. This protein plays a major role in the maintenance and regulation of the cell division cycle. Ki-67, a part of the mitotic chromosome periphery, function as a biological surfactant to maintain individual mitotic chromosomes dispersed in the cytoplasm after nuclear envelope disassembly.
Physical form
Solution in phosphate buffered saline, pH 7.4
Legal Information
GenBank is a registered trademark of United States Department of Health and Human Services
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 7B8, monoclonal |
| form | buffered aqueous solution |
| species reactivity | human |
| technique(s) | immunofluorescence: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| GenBank accession no. | NM_002417 |
| UniProt accession no. | P46013 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MKI67(4288) |
