General description
Alpha-synuclein is a member of the synuclein family, which also includes beta- and gamma-synuclein. Synucleins are abundantly expressed in the brain and alpha- and beta-synuclein inhibit phospholipase D2 selectively. SNCA may serve to integrate presynaptic signaling and membrane trafficking. Defects in SNCA have been implicated in the pathogenesis of Parkinson disease. SNCA peptides are a major component of amyloid plaques in the brains of patients with Alzheimer′s disease. Alternatively spliced transcripts encoding different isoforms have been identified for this gene.
Immunogen
PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.
Recombinant fusion protein containing a sequence corresponding to amino acids 59-140 of human alpha-Synuclein (NP_000336.1).
Application
WB, IHC
| biological source | rabbit |
| Quality Level | 100 |
| material | colorless |
| clone | 10Y4X3, monoclonal |
| form | liquid |
| mol wt | 18 kDa |
| species reactivity | rat, human |
| concentration | 1mg/mL |
| technique(s) | immunohistochemistry: 1:50 - 1:200,western blot: 1:500 - 1:1000 |
| color | colorless |
| isotype | IgG |
| immunogen sequence | TKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFVKKDQLGKNEEGAPQEGILEDMPVDPDNEAYEMPSEEGYQDYEPEA |
| UniProt accession no. | P37840 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... SNCA(6622) |
