General description
C13ORF8 (CAMP, ZNF828) is a zinc finger protein that has FPE, SPE and WK motifs. This protein is known to regulate kinetochore-microtubule attachment during bi-orientation.
Rabbit Anti-C13ORF8 antibody recognizes human C13ORF8.
Immunogen
Synthetic peptide directed towards the middle region of human C13ORF8
Application
Rabbit Anti-C13ORF8 antibody can be used for immunohistochemical (4-8μg/ml, using paraffin-embedded tissues) and western blotting (1μg/ml) assays.
Biochem/physiol Actions
The function of the C13orf8 gene has not yet been determined.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: PAASPESRKSARTTSPEPRKPSPSESPEPWKPFPAVSPEPRRPAPAVSPG
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | IgG fraction of antiserum |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 89 kDa |
| species reactivity | horse, human |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | NP_115812 |
| UniProt accession no. | Q96JM3 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... C13ORF8(283489) |
