General description
The previously assigned protein identifier A2BDF5 has been merged into P28329. Full details can be found on the UniProt database.
Immunogen
The immunogen for Anti-CHAT antibody: synthetic peptide directed towards the C terminal of human CHAT
Biochem/physiol Actions
CHAT is an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This protein is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: SSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPS
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 70 kDa |
| species reactivity | dog, human, horse |
| concentration | 0.5-1 mg/mL |
| technique(s) | immunoblotting: suitable |
| accession no. | NM_020984 |
| UniProt accession no. | P28329 |
| shipped in | wet ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... CHAT(1103) |
