General description
Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) gene encodes a member of the Ser/Thr protein kinase family. This kinase is regulated through direct phosphorylation by p38 MAP kinase. In conjunction with p38 MAP kinase, this kinase is known to be involved in many cellular processes including stress and inflammatory responses, nuclear export, gene expression regulation and cell proliferation. Heat shock protein HSP27 was shown to be one of the substrates of this kinase in vivo. Two transcript variants encoding two different isoforms have been found for this gene. (provided by RefSeq)The gene is located on human chromosome 1q32.1. It consists of an autoinhibitory domain, a helix-turn-helix structure, which occupies the substrate binding cleft of the kinase domain and inhibits kinase function.
Immunogen
MAPKAPK2 (NP_116584, 266 a.a. ~ 352 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NHGLAISPGMKTRIRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSTKVPQTPLHTSRVLKEDKERWEDV
Biochem/physiol Actions
Mitogen-activated protein kinase-activated protein kinase 2 (MAPKAPK2) is involved in cytokine production and cell migration. Overexpression of MAPKAPK2 confers multiple myeloma (MM) resistance to chemotherapy. It phosphorylates the proteins found in the nucleus and cytoplasm. This protein confers gemcitabine sensitivity in pancreatic cancer cells. The protein is required for tumor necrosis factor (TNF) biosynthesis. It is linked to tumorigenesis and drug resistance. The protein functions as a prognostic marker for lung cancer.
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3B8, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~35.57 kDa |
| species reactivity | human |
| technique(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG2aκ |
| NCBI accession no. | NM_032960 |
| UniProt accession no. | P49137 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... MAPKAPK2(9261) |
