General description
Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein which possesses three functional domains. It belongs to the PARP family and the gene encoding it is localized on human chromosome 1q42.
Immunogen
PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD
Biochem/physiol Actions
Poly (ADP-ribose) polymerase 1 (PARP1) has a role in DNA repair and acts as a facilitator of homologous recombination. It controls transcription by modulating chromatin structure and altering DNA methylation patterns. The protein functions as a co-regulator of transcription factors and associates with chromatin insulators. PARP1 also has an important role in protection of the cardiovascular system.
Physical form
Solution in phosphate buffered saline, pH 7.4
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 2C7, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~37 kDa |
| species reactivity | human |
| technique(s) | capture ELISA: suitable,immunofluorescence: suitable,indirect ELISA: suitable,western blot: 1-5 μg/mL |
| isotype | IgG1κ |
| NCBI accession no. | BC037545 |
| UniProt accession no. | P09874 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... PARP1(142) |
