General description
VDAC2 is a voltage-dependant anion channel that forms a pathway for metabolite diffusion across the outer membrane of mitochondria. Studies have reported that VDAC2 interacts with BAK and subsequently regulates mitochondrial apoptosis/cell death.
Rabbit Anti-VDAC2 antibody recognizes chicken, human, mouse, rat, bovine, pig, canine, rabbit, and zebrafish VDAC2.
Immunogen
Synthetic peptide directed towards the N terminal region of human VDAC2
Application
Rabbit Anti-VDAC2 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.
Biochem/physiol Actions
VDAC2 forms a channel through the mitochondrial outer membrane that allows diffusion of small hydrophilic molecules. The channel adopts an open conformation at low or zero membrane potential and a closed conformation at potentials above 30-40 mV. The open state has a weak anion selectivity whereas the closed state is cation-selective.
Physical form
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Other Notes
Synthetic peptide located within the following region: MATHGQTCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGV
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | rabbit |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | affinity isolated antibody |
| antibody product type | primary antibodies |
| clone | polyclonal |
| form | buffered aqueous solution |
| mol wt | 32 kDa |
| species reactivity | dog, bovine, guinea pig, rabbit, rat, human, horse, mouse |
| concentration | 0.5 mg - 1 mg/mL |
| technique(s) | immunohistochemistry: suitable,western blot: suitable |
| NCBI accession no. | XP_001133585 |
| UniProt accession no. | P45880-5 |
| shipped in | wet ice |
| storage temp. | −20°C |
| Gene Information | human ... VDAC2(7417) |
