General description
Wnt family member 5A (WNT5A) is a secreted, proinflammatory protein. It is part of the noncanonical WNT family. The gene encoding this protein is localized on human chromosome 3p14.3.
Immunogen
WNT5A (AAH64694, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLV
Biochem/physiol Actions
Wnt family member 5A (WNT5A) has a role in metabolic dysfunction in obesity and negatively modulates angiogenesis in adipose tissue. The protein regulates cell motility and polarity by activating β-catenin–independent pathways. It has been shown to be overexpressed in gliomas.
Physical form
Solution in phosphate buffered saline, pH 7.4
Disclaimer
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
| biological source | mouse |
| Quality Level | 100 |
| conjugate | unconjugated |
| antibody form | purified immunoglobulin |
| antibody product type | primary antibodies |
| clone | 3A4, monoclonal |
| form | buffered aqueous solution |
| mol wt | antigen ~37.11 kDa |
| species reactivity | human |
| technique(s) | immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable,indirect ELISA: suitable |
| isotype | IgG2aκ |
| NCBI accession no. | BC064694 |
| UniProt accession no. | P41221 |
| shipped in | dry ice |
| storage temp. | −20°C |
| target post-translational modification | unmodified |
| Gene Information | human ... WNT5A(7474) |
